PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g035867m
Common NameCISIN_1g035867mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 363aa    MW: 40650.2 Da    PI: 5.0568
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g035867mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS329.66.1e-101236125374
               GRAS  25 arlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiD 116
                        + l+el+sp+gd+ q+l +yf++AL  r+++s++++y++l++ ++++ + +++ +++  f+evsP+ +f+h+++N aI+ea+ege+++Hi+D
  orange1.1g035867m   2 WMLNELSSPYGDTDQKLSSYFLQALFGRMTDSGERCYRTLSSASDKTCSFESTRKMVLKFQEVSPWTTFGHVACNGAIMEAFEGESKLHIVD 93 
                        789*************************************9988886665555555566********************************* PP

               GRAS 117 fdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..........skeeleetgerLakfAeelgvpfefnvlvak.rledleleeLrvk 197
                        ++ ++++QWp+Ll+aLa+R++++p+lR+T+v+ ++++           ++ ++e+g+r++kfA+ +gvpfefnv+++  +l dl+l eL+v+
  orange1.1g035867m  94 ISNTYCTQWPTLLEALATRTDDTPHLRLTTVVTSKPVggsgagglaaVQKVMKEIGNRMEKFARLMGVPFEFNVIHHVgDLCDLNLAELDVR 185
                        *********************************998899*******9999************************96666************* PP

               GRAS 198 pgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnse....sFlerflealeyysalfdsleaklpreseerikv 285
                        ++Eala+n++ +lh++     +++++rd +++ ++sl+P++++vve+e+d++ +    +F+++f e+l+++ + f+sl++++ ++s+er ++
  orange1.1g035867m 186 SDEALAINCIGALHTIA----AVDDRRDVLISNLRSLQPRIITVVEEEVDLDVGidglEFVKGFQECLRWFRVYFESLDESFTKTSNERLML 273
                        ****************8....888899*********************8875444555********************************** PP

               GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdg.yrveeesgslvlgWkdrpLvsvSaWr 374
                        Er+  gr+iv++vac+ +e++er+et+ +W+ rl+ aGF+p  +s+++ +++++llr++k +g  + ++ ++ ++l Wkd+++v++SaWr
  orange1.1g035867m 274 ERA-AGRAIVDLVACQPSESTERRETATRWSGRLHGAGFSPFMFSDEVCDDVRALLRRYK-EGwSMAQCPDAGIFLSWKDHTVVWASAWR 361
                        ***.********************************************************.66255568899999**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.3521341IPR005202Transcription factor GRAS
PfamPF035142.1E-982361IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008356Biological Processasymmetric cell division
GO:0009956Biological Processradial pattern formation
GO:0045930Biological Processnegative regulation of mitotic cell cycle
GO:0048366Biological Processleaf development
GO:0055072Biological Processiron ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MWMLNELSSP YGDTDQKLSS YFLQALFGRM TDSGERCYRT LSSASDKTCS FESTRKMVLK  60
FQEVSPWTTF GHVACNGAIM EAFEGESKLH IVDISNTYCT QWPTLLEALA TRTDDTPHLR  120
LTTVVTSKPV GGSGAGGLAA VQKVMKEIGN RMEKFARLMG VPFEFNVIHH VGDLCDLNLA  180
ELDVRSDEAL AINCIGALHT IAAVDDRRDV LISNLRSLQP RIITVVEEEV DLDVGIDGLE  240
FVKGFQECLR WFRVYFESLD ESFTKTSNER LMLERAAGRA IVDLVACQPS ESTERRETAT  300
RWSGRLHGAG FSPFMFSDEV CDDVRALLRR YKEGWSMAQC PDAGIFLSWK DHTVVWASAW  360
RP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-391236137375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006466443.10.0PREDICTED: protein SHORT-ROOT
SwissprotQ9SZF70.0SHR_ARATH; Protein SHORT-ROOT
TrEMBLA0A067GTX00.0A0A067GTX0_CITSI; Uncharacterized protein
STRINGVIT_07s0129g00030.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61042547
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.10.0GRAS family protein